Growth Hormone
IGF-DES (1-3)
Truncated IGF-1 variant lacking the first three N-terminal amino acids. Ten times more potent than intact IGF-1 due to reduced binding protein affinity. Used in targeted anabolic and cell proliferation research.
Research specifications
- Purity
- ≥95%
- Unit
- 1mg
- Sequence
- TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Length
- 67 amino acids
- Molecular weight
- 7371.4
- Availability
- In stock